Håll mig inloggad?
Avslutas om 
Din inloggning har gått ut
Din session har gått ut. För din säkerhet har vi loggat ut dig.
Vill du logga in igen?

Anti-Solute Carrier Family 25 Member 11 Mouse Monoclonal Antibody [clone: 3G4]

Leverantör: US Biological
Recommended dilution: Immunochemistry: 3μg/ml

Type: Primary
Antigen: Solute Carrier Family 25 Member 11
Clonality: monoclonal
Clone: 3G4
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 Kappa
Reactivity: Human



 

ORDER

Expandera alla / Komprimera alla
Storlek Förp. VWR art.nr Antal
100 µg 100 µG USBI133701
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFIKATIONER

Antigen symbol Solute Carrier Family 25 Member 11
Reaktivitet Human
Conjugation Unconjugated
Clonality Monoclonal
Antikroppstyp Primary
Clone 3G4
Värd Mouse
Isotype IgG1 kappa
Western blot Yes
ELISA Yes
Rening purified by Protein A chromatography
Sequence MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDG
Form liquid
Storage buffer PBS, pH 7,2.
Förvaringstemperatur Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indikera Batch Nummer. Detta fält är obligatoriskt. Ange "x" om detta inte finns för VWR kemikalier

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beskrivning Artikel nummer Availability Enhet Ditt pris Price Per Antal
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping