Håll mig inloggad?
Avslutas om 
Din inloggning har gått ut
Din session har gått ut. För din säkerhet har vi loggat ut dig.
Vill du logga in igen?

Anti-SPAG5 Mouse Monoclonal Antibody [clone: 5F9]

Leverantör: US Biological
Type: Primary
Antigen: SPAG5 (sperm associated antigen 5)
Clonality: monoclonal
Clone: 5F9
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG3 Kappa
Reactivity: Human




 

ORDER

Expandera alla / Komprimera alla
Storlek Förp. VWR art.nr Antal
100 µg 100 µG USBI133742
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFIKATIONER

Antigen symbol SPAG5
Antigen name sperm associated antigen 5
Reaktivitet Human
Conjugation Unconjugated
Clonality Monoclonal
Antikroppstyp Primary
Clone 5F9
Värd Mouse
Isotype IgG3 kappa
Western blot Yes
ELISA Yes
Rening purified by Protein A chromatography
Sequence AETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEF
Form liquid
Storage buffer PBS, pH 7,2.
Förvaringstemperatur Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indikera Batch Nummer. Detta fält är obligatoriskt. Ange "x" om detta inte finns för VWR kemikalier

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Beskrivning Artikel nummer Availability Enhet Ditt pris Price Per Antal
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping