Håll mig inloggad?
Avslutas om 
Din inloggning har gått ut
Din session har gått ut. För din säkerhet har vi loggat ut dig.
Vill du logga in igen?

Anti-SPDEF Mouse Monoclonal Antibody [clone: 4A5]

Leverantör: US Biological
Type: Primary
Antigen: SPDEF (SAM pointed domain containing ETS transcription factor)
Clonality: monoclonal
Clone: 4A5
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human



Logga in för att se avtalspriser och tillgänglighet.
  Kom ihåg mig i den här enheten
 

ORDER

Expandera alla / Komprimera alla
Storlek Förp. VWR art.nr Antal
100 µg 100 µG USBI133756
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFIKATIONER

Antigen symbol SPDEF
Antigen name SAM pointed domain containing ETS transcription factor
Reaktivitet Human
Conjugation Unconjugated
Clonality Monoclonal
Antikroppstyp Primary
Clone 4A5
Värd Mouse
Isotype IgG2b kappa
Western blot Yes
ELISA Yes
Aminosyretal 92 to 201
Rening purified by Protein A chromatography
Sequence QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGD*
Form liquid
Storage buffer PBS, pH 7,2.
Förvaringstemperatur Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indikera Batch Nummer. Detta fält är obligatoriskt. Ange "x" om detta inte finns för VWR kemikalier

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Benämning Artikel nummer Availability Enhet Ditt pris Price Per Antal