Håll mig inloggad?
Avslutas om 
Din inloggning har gått ut
Din session har gått ut. För din säkerhet har vi loggat ut dig.
Vill du logga in igen?

Anti-H1FX Mouse Monoclonal Antibody

Leverantör: Abnova

Mouse monoclonal antibody raised against a full-length recombinant H1FX.

Type: Primary
Antigen: H1FX
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Logga in för att se avtalspriser och tillgänglighet.
  Kom ihåg mig i den här enheten
 

ORDER

Expandera alla / Komprimera alla
Storlek Förp. VWR art.nr Antal
Up to 5 Clones 1 ABNOH00008971-M
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

SPECIFIKATIONER

Antigen symbol H1FX
Antigen name H1 histone family, member X
Reaktivitet Human
Conjugation Unconjugated
Clonality Monoclonal
Antikroppstyp Primary
Värd Mouse
Western Blot Yes
ELISA Yes
Antigen synonymer H1X, H1.10
Aminosyretal 1 to 213
Gen 8971
Mått Liquid
Cross Adsorption No
Immunogen H1FX (NP_006017.1, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
Enter Details

Select the article for which you are looking for Certificate

Indikera Batch Nummer. Detta fält är obligatoriskt. Ange "x" om detta inte finns för VWR kemikalier

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Eller
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Benämning Artikel nummer Availability Enhet Ditt pris Price Per Antal